JUN

JUN
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1A02, 1JNM, 1JUN, 1S9K, 1T2K, 1FOS

Ідентифікатори
Символи JUN, AP-1, AP1, c-Jun, Jun proto-oncogene, AP-1 transcription factor subunit, p39, cJUN
Зовнішні ІД OMIM: 165160 MGI: 96646 HomoloGene: 1679 GeneCards: JUN
Онтологія гена
Молекулярна функція

GO:0005097, GO:0005099, GO:0005100 GTPase activator activity
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
cAMP response element binding
R-SMAD binding
HMG box domain binding
transcription factor binding
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
enzyme binding
chromatin binding
GO:0001948, GO:0016582 protein binding
double-stranded DNA binding
DNA binding
sequence-specific DNA binding
GO:0001105 transcription coactivator activity
identical protein binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
RNA binding
protein homodimerization activity
protein heterodimerization activity
ubiquitin protein ligase binding
ubiquitin-like protein ligase binding
GO:0000975 transcription cis-regulatory region binding

Клітинна компонента

гіалоплазма
transcription repressor complex
клітинне ядро
nuclear chromosome
нуклеоплазма
transcription regulator complex
transcription factor AP-1 complex

Біологічний процес

GO:1904089 negative regulation of neuron apoptotic process
negative regulation of DNA binding
outflow tract morphogenesis
transcription by RNA polymerase II
навчення
monocyte differentiation
response to organic substance
leading edge cell differentiation
Fc-epsilon receptor signaling pathway
positive regulation of neuron apoptotic process
cellular response to hormone stimulus
regulation of DNA-binding transcription factor activity
циркадний ритм
Ангіогенез
positive regulation of ERK1 and ERK2 cascade
Ras protein signal transduction
transforming growth factor beta receptor signaling pathway
negative regulation of cell population proliferation
response to muscle stretch
cellular response to calcium ion
response to cytokine
GO:0009373 regulation of transcription, DNA-templated
SMAD protein signal transduction
axon regeneration
positive regulation of fibroblast proliferation
response to mechanical stimulus
positive regulation of epithelial cell migration
positive regulation of DNA-templated transcription, initiation
transcription, DNA-templated
positive regulation of cell differentiation
positive regulation of monocyte differentiation
positive regulation of pri-miRNA transcription by RNA polymerase II
negative regulation of protein autophosphorylation
membrane depolarization
negative regulation of apoptotic process
eyelid development in camera-type eye
microglial cell activation
positive regulation of DNA replication
response to lipopolysaccharide
response to radiation
response to cAMP
GO:0045996 negative regulation of transcription, DNA-templated
response to hydrogen peroxide
positive regulation of smooth muscle cell proliferation
positive regulation of endothelial cell proliferation
GO:1904578 response to organic cyclic compound
GO:0010260 старіння людини
regulation of cell cycle
regulation of cell population proliferation
positive regulation of cell population proliferation
liver development
negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
cellular response to potassium ion starvation
GO:0006928 клітинний процес
release of cytochrome c from mitochondria
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
GO:0072353 cellular response to reactive oxygen species
positive regulation of apoptotic process
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
cellular response to cadmium ion
GO:1901227 negative regulation of transcription by RNA polymerase II
positive regulation of vascular associated smooth muscle cell proliferation

Джерела:Amigo / QuickGO
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
3725
16476
Ensembl
ENSG00000177606
ENSMUSG00000052684
UniProt
P05412
P05627
RefSeq (мРНК)
NM_002228
NM_010591
RefSeq (білок)
NP_002219
NP_034721
Локус (UCSC) Хр. 1: 58.78 – 58.78 Mb Хр. 4: 94.94 – 94.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JUN (англ. Jun proto-oncogene, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 331 амінокислот, а молекулярна маса — 35 676[4].

Послідовність амінокислот
1020304050
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK
PHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCP
KNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASV
AGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQ
PQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQ
ERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • Hattori K., Angel P., le Beau M.M., Karin M. (1988). Structure and chromosomal localization of the functional intronless human JUN protooncogene. Proc. Natl. Acad. Sci. U.S.A. 85: 9148—9152. PMID 3194415 DOI:10.1073/pnas.85.23.9148
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bannister A.J., Gottlieb T.M., Kouzarides T., Jackson S.P. (1993). c-Jun is phosphorylated by the DNA-dependent protein kinase in vitro; definition of the minimal kinase recognition motif. Nucleic Acids Res. 21: 1289—1295. PMID 8464713 DOI:10.1093/nar/21.5.1289
  • Enslen H., Tokumitsu H., Stork P.J., Davis R.J., Soderling T.R. (1996). Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade. Proc. Natl. Acad. Sci. U.S.A. 93: 10803—10808. PMID 8855261 DOI:10.1073/pnas.93.20.10803
  • Kirstein M., Sanz L., Moscat J., Diaz-Meco M.T., Saus J. (1996). Cross-talk between different enhancer elements during mitogenic induction of the human stromelysin-1 gene. J. Biol. Chem. 271: 18231—18236. PMID 8663478 DOI:10.1074/jbc.271.30.18231
  • Claret F.-X., Hibi M., Dhut S., Toda T., Karin M. (1996). A new group of conserved coactivators that increase the specificity of AP-1 transcription factors. Nature. 383: 453—457. PMID 8837781 DOI:10.1038/383453a0

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6204 (англ.) . Процитовано 25 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P05412 (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 25 серпня 2017.

Див. також

  • Хромосома 1
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

Фактори транскрипції та внутрішньоклітинні рецептори
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші