WNT10B

WNT10B
Ідентифікатори
Символи WNT10B, SHFM6, WNT-12, Wnt family member 10B, STHAG8
Зовнішні ІД OMIM: 601906 MGI: 108061 HomoloGene: 20721 GeneCards: WNT10B
Пов'язані генетичні захворювання
split hand-foot malformation 2[1]
Онтологія гена
Молекулярна функція

• receptor ligand activity
• GO:0005110 frizzled binding
• signaling receptor binding

Клітинна компонента

• extracellular region
• міжклітинний простір

Біологічний процес

• cellular response to organic substance
• myoblast differentiation involved in skeletal muscle regeneration
• cellular response to retinoic acid
• cell fate commitment
• negative regulation of fat cell differentiation
• positive regulation of RNA polymerase II transcription preinitiation complex assembly
• chondrocyte differentiation
• positive regulation of bone mineralization
• lipid metabolism
• positive regulation of canonical Wnt signaling pathway
• GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
• hematopoietic stem cell proliferation
• GO:1904579 cellular response to organic cyclic compound
• protein stabilization
• positive regulation of DNA-binding transcription factor activity
• positive regulation of ossification
• GO:1901227 negative regulation of transcription by RNA polymerase II
• bone trabecula formation
• positive regulation of timing of anagen
• regulation of fat cell differentiation
• multicellular organism development
• positive regulation of epithelial cell differentiation
• positive regulation of osteoblast differentiation
• fungiform papilla development
• skeletal muscle tissue regeneration
• G2/M transition of mitotic cell cycle
• skeletal muscle fiber development
• neuron differentiation
• positive regulation of cell population proliferation
• negative regulation of epithelial cell proliferation
• positive regulation of apoptotic process
• regulation of proteasomal ubiquitin-dependent protein catabolic process
• canonical Wnt signaling pathway
• regulation of skeletal muscle tissue development
• positive regulation of G2/M transition of mitotic cell cycle
• smoothened signaling pathway
• cellular response to parathyroid hormone stimulus
• regulation of protein metabolic process
• sensory perception of taste
• cellular response to cAMP
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• Wnt signaling pathway
• regulation of signaling receptor activity
• negative regulation of cold-induced thermogenesis

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
7480
22410
Ensembl
ENSG00000169884
ENSMUSG00000022996
UniProt
O00744
P48614
RefSeq (мРНК)
NM_003394
NM_011718
RefSeq (білок)
NP_003385
NP_035848
Локус (UCSC) Хр. 12: 48.97 – 48.97 Mb Хр. 15: 98.67 – 98.68 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

WNT10B (англ. Wnt family member 10B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 389 амінокислот, а молекулярна маса — 43 000[5].

Послідовність амінокислот
1020304050
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLT
LSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGG
GRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKG
SGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCN
HDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCH
GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCG
RGHNVLRQTRVERCHCRFHWCCYVLCDECKVTEWVNVCK

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як сигнальний шлях Wnt, альтернативний сплайсинг. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Wend P., Wend K., Krum S.A., Miranda-Carboni G.A. (2012). The role of WNT10B in physiology and disease. Acta Physiol. 204: 34—51. PMID 21447090 DOI:10.1111/j.1748-1716.2011.02296.x
  • Ugur S.A., Tolun A. (2008). Homozygous WNT10b mutation and complex inheritance in Split-Hand/Foot Malformation. Hum. Mol. Genet. 17: 2644—2653. PMID 18515319 DOI:10.1093/hmg/ddn164
  • Hardiman G., Kastelein R.A., Bazan J.F. (1997). Isolation, characterization and chromosomal localization of human WNT10B. Cytogenet. Cell Genet. 77: 278—282. PMID 9284937
  • Saitoh T., Kirikoshi H., Mine T., Katoh M. (2001). Proto-oncogene WNT10B is up-regulated by tumor necrosis factor alpha in human gastric cancer cell line MKN45. Int. J. Oncol. 19: 1187—1192. PMID 11713588

Примітки

  1. ↑ Захворювання, генетично пов'язані з WNT10B переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:12775 (англ.) . Процитовано 11 вересня 2017.
  5. ↑ UniProt, O00744 (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 11 вересня 2017.

Див. також

  • Хромосома 12
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.